Pay in 4 interest-free payments of $7.05 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
doi: 10.1007/978-1-0716-0536-3_1 69 DandoS
This formulation bypasses reconstitution steps and supports consistent delivery for advanced regenerative, vascular, and musculoskeletal studies
GCL is in part regulated by GSH feedback inhibition, thus if GSH is depleted due to oxidative stress, inflammation, or exposure to xenobiotics, de novo synthesis of GSH is upregulated, as is cysteine synthesis
Nrf2 mediates the DNA methylation level of RANKL promoter by regulating the activity of DNA methyltransferase 3a, participating in the regulation of ferroptosis in osteoclasts and bone homeostasis
43 amino acids Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES Formula / M.W.: C 212 H 350 N 56 O 78 S, ~4963.44 g/mol CAS: 77591-33-4 Disclaimer This product is intended for laboratory research use only
US$ 24.22
US$ 28.44
US$ 26.62
US$ 29.17
US$ 23.96
US$ 23.33
US$ 23.40
US$ 23.50
US$ 22.04